PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG305300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 231aa    MW: 25146.3 Da    PI: 9.9028
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG305300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.3e-1894148256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++tkeq + Le+ F+ ++ +s++++ eLA++++L+ rqV vWFqNrRa+ k
  Pavir.4NG305300.1.p  94 RKKLRLTKEQSTLLEDTFRAHNILSHAQKHELAHQVNLSARQVEVWFQNRRARTK 148
                          788899***********************************************98 PP

2HD-ZIP_I/II114.18.6e-3794182189
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                          +kk+rl+keq++lLE++F++++ L++ +K+ela++++l++rqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+ en+rL++e ++L++
  Pavir.4NG305300.1.p  94 RKKLRLTKEQSTLLEDTFRAHNILSHAQKHELAHQVNLSARQVEVWFQNRRARTKLKQTEVDCEILKRCCESLTGENQRLKHELAQLQR 182
                          69************************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-1982151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-1882149IPR009057Homeodomain-like
PROSITE profilePS5007117.11990150IPR001356Homeobox domain
SMARTSM003899.1E-1492154IPR001356Homeobox domain
CDDcd000861.39E-1394151No hitNo description
PfamPF000468.6E-1694148IPR001356Homeobox domain
PROSITE patternPS000270125148IPR017970Homeobox, conserved site
SMARTSM003406.4E-14150192IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-9150181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MYSASAMEAE DFGKSWLGLG IGGGDLKRSH GERRSAVRLD LLFPQQSVKE EEAAVGSTKA  60
EKGARKRLKI TDDDGVGRRS LEPSPSDDGG AGARKKLRLT KEQSTLLEDT FRAHNILSHA  120
QKHELAHQVN LSARQVEVWF QNRRARTKLK QTEVDCEILK RCCESLTGEN QRLKHELAQL  180
QRSAAAGLYV QLPRRGAPPA KATICPSCDK VTLTTSGGET SKSSSGSYSS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142150RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9554318e-46EU955431.1 Zea mays clone 1531862 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966133.11e-119PREDICTED: homeobox-leucine zipper protein HOX18-like
SwissprotQ5Z6F68e-59HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLK3XZ801e-117K3XZ80_SETIT; Uncharacterized protein
STRINGSi007238m1e-117(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-45homeobox protein 2